PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009599412.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 541aa    MW: 60926.8 Da    PI: 4.414
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009599412.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.57.4e-55101381128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtdeelv +yL++k++gk+++    i+++diykvePwdLp k ++k+++ ewyfFs  dkky +g r+nrat++gyWk+tgkd++v+
  XP_009599412.1  10 LAPGFRFHPTDEELVRYYLRRKITGKPIKS-APISDIDIYKVEPWDLPgKsRLKTRDLEWYFFSVLDKKYGNGARTNRATEKGYWKTTGKDRAVH 103
                     579************************999.78***************6347777888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++k+++vg+kktLvf++grapkg++t+Wvmheyrl
  XP_009599412.1 104 RNKSQVVGMKKTLVFHSGRAPKGQRTNWVMHEYRL 138
                     *********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-629161IPR003441NAC domain
PROSITE profilePS5100559.31510161IPR003441NAC domain
PfamPF023651.3E-2812138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 541 aa     Download sequence    Send to blast
MESRGSLKSL APGFRFHPTD EELVRYYLRR KITGKPIKSA PISDIDIYKV EPWDLPGKSR  60
LKTRDLEWYF FSVLDKKYGN GARTNRATEK GYWKTTGKDR AVHRNKSQVV GMKKTLVFHS  120
GRAPKGQRTN WVMHEYRLID EELDRAGIPQ DAFVVCRVFQ KSGAGPKNGE QYGAPFIEEE  180
WEDDELQVLL KDEAADEFVF DDDIYLDGIE LDQILGTETT LNSAPLPLDY CYGENGSSEE  240
TNNSSDAQNW LQQPDELKPI DLAVQQNVDV DPVMHEYIGE SSKNVNSEDV DYLLNEPTVN  300
ATDDLQFKEE AFLEANDLSN PIEVDSSGFD MLEEYLTFFD ANDDFQNMGF DPSVLFGNDD  360
QISDQALPAE KNIGEVTQQF IAPNEGLGEY KNDFASSSKL EPTKFGSDHQ YPFMKRASKM  420
LGNIHAPPAF ASEFPTKDAT LRLNSLSQTS SSVQVTAGFQ IRDMTVGSNG TGWPLGKHAD  480
YNIFLSFGIS RGSDESAVES FYSIHPGKTT SIISRGWFYY LFFSFLMLCM SFKIGTIICA  540
S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-45916719174NAC domain-containing protein 19
3swm_B1e-45916719174NAC domain-containing protein 19
3swm_C1e-45916719174NAC domain-containing protein 19
3swm_D1e-45916719174NAC domain-containing protein 19
3swp_A1e-45916719174NAC domain-containing protein 19
3swp_B1e-45916719174NAC domain-containing protein 19
3swp_C1e-45916719174NAC domain-containing protein 19
3swp_D1e-45916719174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009599412.10.0PREDICTED: NAC domain-containing protein 78-like
TrEMBLM1D2F90.0M1D2F9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000797890.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31412450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-128NAC domain containing protein 2